DPCfam | MC36259
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 503 ± 79 aa |
| Residues in low-complexity regions (%) | 3.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.13 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF07217 |
| Sequences matching dominant architecture (%) | 75.36 |
| Average overlap percent | 91.32 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00041AE1B4 | 300-781 | 482 | QEFSNEEVSMTYFGNWMRDMNQVMVPAFADAIGNDGAFALIKILALKKFGREINPELFGYYIPSEHIDNPAGQVPGADYFTSAPA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VRE9-F1 | 27-579 | 99.81 | 82.07 | View in AlphaFoldDB ↗ |