DPCfam | MC362427
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 511 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Residues in low-complexity regions (%) | 1.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.53 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF08783 |
| Sequences matching dominant architecture (%) | 99.76 |
| Average overlap percent | 92.47 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A137PDJ2 | 2-79 | 78 | SLIHYKFRAAKDFSSITFEGLSLSLFELKKEILLAKKLKGTDFDIVISNAQTNEEYSDDQTLIPKNTNVFVKRVPASG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7Z6E9-F1 | 2-78 | 97.50 | 91.01 | View in AlphaFoldDB ↗ |