DPCfam | MC362155
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 84 ± 4 aa |
| Residues in low-complexity regions (%) | 0.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03237 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 41.37 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P9YCL1 | 114-191 | 78 | KTYFSTPSAVSHQAYPFWQGEKFRNSKRKNAKEPWPSDKQISAGALCPDGQWRKVITILDAIAGGCDLFDLEQLQLEY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZMT0-F1 | 269-353 | 98.84 | 95.66 | View in AlphaFoldDB ↗ |