DPCfam | MC361981
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 70 ± 9 aa |
| Residues in low-complexity regions (%) | 6.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.27 |
| Average transmembrane regions | 0.75 |
| Dominant Pfam architecture(s) | PF02433 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 42.18 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A090SQI7 | 5-75 | 71 | ISKSSFAFITITTIVVMFSFFVWVFPSFFYSNDLAKKTTAQPYTALELAGRDVYMSQGCVSCHTQMVRNIE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I3G1-F1 | 6-74 | 100.00 | 96.56 | View in AlphaFoldDB ↗ |