DPCfam | MC361836
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Residues in low-complexity regions (%) | 1.02 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.66 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K4D4A6 | 7-65 | 59 | KAENIGKGKVTPIQVAFIVDRYLSDNDFSETRSTFCSEASHILSNLPVKEAPRSLLSLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7L1N1-F1 | 5-67 | 93.85 | 74.37 | View in AlphaFoldDB ↗ |