DPCfam | MC36157
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 569 ± 53 aa |
| Residues in low-complexity regions (%) | 7.99 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.08 |
| Average transmembrane regions | 3.76 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q6CUV7 | 5-603 | 599 | YLKLNERLSQIWCNKYTIIILVMMVKILLFIKMLSNGFENIMDYTMENCRNIDYYYSKYVNSSPHYMGLMGNFLIQKSMEQSVAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1CWM3-F1 | 40-615 | 100.00 | 76.03 | View in AlphaFoldDB ↗ |