DPCfam | MC361488
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 146 ± 20 aa |
| Residues in low-complexity regions (%) | 9.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.26 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05672 |
| Sequences matching dominant architecture (%) | 0.32 |
| Average overlap percent | 35.22 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V6RGD8 | 7-143 | 137 | PNYKDLYLQAEKGRQQAEEREKQEAERRRQAEERNQHTSFTELLQHCHDLISRRLRVETPSRSTTGKIPPPTGKDYLTRLEHWTD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NPS5-F1 | 17-176 | 98.74 | 88.00 | View in AlphaFoldDB ↗ |