DPCfam | MC361387
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1011 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Residues in low-complexity regions (%) | 15.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.32 |
| Average transmembrane regions | 2.79 |
| Dominant Pfam architecture(s) | PF10101 |
| Sequences matching dominant architecture (%) | 88.87 |
| Average overlap percent | 27.09 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X0WU35 | 97-179 | 83 | FWSHMCISVMWAVYGAALMVAGFWRNIKLLRYIALGLFVLLLVKVFILDTSTVKNVYRIAAFFATGVTLVGVSYLYQYLKKKG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8F5L6-F1 | 410-494 | 93.10 | 87.39 | View in AlphaFoldDB ↗ |