DPCfam | MC361355
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 100 ± 13 aa |
| Residues in low-complexity regions (%) | 2.1 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.72 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF00550 |
| Sequences matching dominant architecture (%) | 7.55 |
| Average overlap percent | 39.48 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G0YP85 | 7-102 | 96 | ELVMALEEAFGVELKDDEVVHTTTPRMVGDVIFSKLQSTDRKVCQSQRSFYLLRKAVMRRFGLQRSFVTPDMPFRNLIPRSKEKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B7KL68-F1 | 38-81 | 40.74 | 91.12 | View in AlphaFoldDB ↗ |