DPCfam | MC36131
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 662 ± 183 aa |
| Residues in low-complexity regions (%) | 4.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.01 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF00370 |
| Sequences matching dominant architecture (%) | 1.26 |
| Average overlap percent | 2.41 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q0CGC6 | 79-958 | 880 | SYQLTKEDAETLFSGAPYFLLEKGKHGHYYPQVIFPFDDHDPSIQNLWDRRPLPHPAYTICTLHAHLPVPDKWVIEGDAPVYLNR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q041-F1 | 287-1379 | 100.00 | 67.21 | View in AlphaFoldDB ↗ |