DPCfam | MC361285
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1491 |
|---|---|
| Mean domain length (aa) | 71 ± 11 aa |
| Residues in low-complexity regions (%) | 5.46 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.35 |
| Average transmembrane regions | 1.06 |
| Dominant Pfam architecture(s) | PF07690 |
| Sequences matching dominant architecture (%) | 52.46 |
| Average overlap percent | 22.43 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A135H3T2 | 184-252 | 69 | SPEQLLSWGWRIPFLASFVMVVIGLFVRVRVSESPVFLESQSAKAPAQVPIITLAKHHWREVLLAAGTY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GWQ8-F1 | 181-249 | 97.01 | 78.87 | View in AlphaFoldDB ↗ |