DPCfam | MC360861
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Residues in low-complexity regions (%) | 4.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A02060A | 222-278 | 57 | VDWPGRGWTGADLDGLSEFLVRVMLSFLAEAAPTRHDPAALRVFLRRWVGPAIHVAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8F6P7-F1 | 1-60 | 84.29 | 92.14 | View in AlphaFoldDB ↗ |