DPCfam | MC360744
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 137 ± 19 aa |
| Residues in low-complexity regions (%) | 7.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.47 |
| Average transmembrane regions | 1.99 |
| Dominant Pfam architecture(s) | PF07647 |
| Sequences matching dominant architecture (%) | 0.43 |
| Average overlap percent | 25.98 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G3P3Y1 | 116-244 | 129 | DKLDEEEGQFFRELTSKYLQPVPEDKGKQEIMINKLRELRNKMTFVYFIINAFWLVVTFTLQLLDSSVFIRVPKINFDLEYTGEY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G5EBQ8-F1 | 1332-1486 | 98.61 | 77.73 | View in AlphaFoldDB ↗ |