DPCfam | MC360698
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 167 ± 20 aa |
| Residues in low-complexity regions (%) | 3.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.67 |
| Average transmembrane regions | 0.27 |
| Dominant Pfam architecture(s) | PF03568 |
| Sequences matching dominant architecture (%) | 96.97 |
| Average overlap percent | 23.51 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A5AI53 | 10-154 | 145 | IRLAPESLQGLEEFVMKFFEDLPCTTVICISLLGGALASLLRELLNYPSSVNAWVLLSHLNMKSQPVVILLPVDSVLEEVSDDDA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0FW02-F1 | 1571-1739 | 99.42 | 73.93 | View in AlphaFoldDB ↗ |