DPCfam | MC360455
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 438 ± 61 aa |
| Residues in low-complexity regions (%) | 2.99 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.34 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01426- PF00145 |
| Sequences matching dominant architecture (%) | 37.01 |
| Average overlap percent | 49.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R0K9Z7 | 728-1097 | 370 | TEIRWEGEPEGKTSSGYPVYKQAIIRGEVISVGRSVLVEVDETDEFPDIYYVEYMFESKIGRKMFHGRMMQRGCQTVLGNAANER... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q92072-F1 | 657-1134 | 99.27 | 87.93 | View in AlphaFoldDB ↗ |