DPCfam | MC359414
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 186 ± 40 aa |
| Residues in low-complexity regions (%) | 4.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.03 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01857 |
| Sequences matching dominant architecture (%) | 90.09 |
| Average overlap percent | 76.45 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000674B3CB | 827-1029 | 203 | SLALFFRKVYHLASVRLRDLFDKLDIDDEELLKKVWTCFEYAMVHNVHLMMDRHLDQLIMCSLYLIAKVTEKPLTFQNIMKCYRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7FDM3-F1 | 768-1002 | 98.31 | 69.98 | View in AlphaFoldDB ↗ |