DPCfam | MC359229
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 906 ± 129 aa |
| Residues in low-complexity regions (%) | 2.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.07 |
| Average transmembrane regions | 0.19 |
| Dominant Pfam architecture(s) | PF09462 |
| Sequences matching dominant architecture (%) | 92.59 |
| Average overlap percent | 66.59 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B0DI96 | 1034-1937 | 904 | NLRADMGIRFLHSGIAFWPRTFIRVGYLHELVSVITFSMEPPLPPKTMLCGFEFGPATNIREFCSFLPNICSAMLEFETSLPDED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VVE2-F1 | 936-1827 | 100.00 | 86.96 | View in AlphaFoldDB ↗ |