DPCfam | MC35916
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 8431 |
|---|---|
| Mean domain length (aa) | 397 ± 60 aa |
| Residues in low-complexity regions (%) | 3.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.35 |
| Average transmembrane regions | 0.18 |
| Dominant Pfam architecture(s) | PF00201 |
| Sequences matching dominant architecture (%) | 61.59 |
| Average overlap percent | 47.81 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B2VSF3 | 21-490 | 470 | ILVYSPSYSTSHLMGNARIADTLAEAGHNVVLFIPEYMPTNFKGTKLAKIIKMAKISESFERHMEMFATDFLSKHTLSMHTRLEW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0K0E427-F1 | 22-452 | 97.36 | 89.46 | View in AlphaFoldDB ↗ |