DPCfam | MC35915
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1511 |
|---|---|
| Mean domain length (aa) | 121 ± 18 aa |
| Residues in low-complexity regions (%) | 1.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.35 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03432 |
| Sequences matching dominant architecture (%) | 85.56 |
| Average overlap percent | 58.2 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005A74BEC | 79-174 | 96 | HIPIRTAPGDRQLTDAEWASVARRVLTAGGLLVDGDTKGPRWIAVRHADDHIHLLVGLVRQDGRAPEQPKYWIKEMRREVDRIEQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q00191-F1 | 48-156 | 90.18 | 94.31 | View in AlphaFoldDB ↗ |