DPCfam | MC359135
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Residues in low-complexity regions (%) | 0.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W3XB66 | 20-95 | 76 | FLTLLAGSALAGDVPKSYSTRDPCPVTCDTAAGGAWSVYTNVKRVEACDKHMLLDFALHNPLDDPSTTVKIRACTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W6R6-F1 | 35-92 | 90.62 | 84.77 | View in AlphaFoldDB ↗ |