DPCfam | MC359034
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 491 |
|---|---|
| Mean domain length (aa) | 343 ± 36 aa |
| Residues in low-complexity regions (%) | 2.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.82 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF07075 |
| Sequences matching dominant architecture (%) | 98.84 |
| Average overlap percent | 91.88 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J5AX41 | 20-367 | 348 | STVGSRRVGLITGPSAWTADRGHPIDFLRREATLAALFAPEHGVWGQAQAGVHVASTIDARTGLPAHSLYDENQEPSAEMLEGLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P40407-F1 | 51-393 | 99.42 | 96.47 | View in AlphaFoldDB ↗ |