DPCfam | MC358979
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 135 ± 15 aa |
| Residues in low-complexity regions (%) | 1.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.65 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07496- PF01429 |
| Sequences matching dominant architecture (%) | 69.66 |
| Average overlap percent | 91.27 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A022Q8U2 | 10-122 | 113 | IRRNTSKDRRTAREWRPEISCKDESDVKQDGTMRWAMDRPRIPQTPSGWQRILRIRAEGGTKFADVYYVAPSNKRLRSMVELHRY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7K117-F1 | 97-237 | 99.29 | 93.06 | View in AlphaFoldDB ↗ |