DPCfam | MC358854
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Residues in low-complexity regions (%) | 12.21 |
| Residues in coiled-coil regions (%) | 6.09 |
| Predicted disordered residues (%) | 36.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06412 |
| Sequences matching dominant architecture (%) | 4.61 |
| Average overlap percent | 44.34 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00077C3931 | 8-104 | 97 | DFEKIQSEIEKQSLRKKAIQDKIKSTKRKHDNQIDYQKNYQLRKERTHRLVQKGALFEKYIEEHLSDTFEDTLTPQESEFLLDVF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P07114-F1 | 11-85 | 97.37 | 97.16 | View in AlphaFoldDB ↗ |