DPCfam | MC358758
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 90 ± 12 aa |
| Residues in low-complexity regions (%) | 5.57 |
| Residues in coiled-coil regions (%) | 4.54 |
| Predicted disordered residues (%) | 35.37 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15251 |
| Sequences matching dominant architecture (%) | 45.4 |
| Average overlap percent | 55.52 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A197JJ60 | 84-160 | 77 | ETPEQVLLASFKAAALSVTQLYKDSLKNQRAEHAKGYEAALQDLLAFMTTHPVVQEKKDLGMSEDEIRQTTSLSIDD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PSM2-F1 | 55-128 | 94.38 | 83.40 | View in AlphaFoldDB ↗ |