DPCfam | MC358742
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 55 ± 4 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.76 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00637 |
| Sequences matching dominant architecture (%) | 95.29 |
| Average overlap percent | 42.95 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R1G4I0 | 599-655 | 57 | QVADAIMANEMFHHYDRPRIAMLCEKAGLAARALEHYDNVEDMKRAMMRTELIPPEF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1D8PPS9-F1 | 596-652 | 100.00 | 80.55 | View in AlphaFoldDB ↗ |