DPCfam | MC358466
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 225 ± 37 aa |
| Residues in low-complexity regions (%) | 2.17 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 25.73 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A163MG97 | 41-276 | 236 | EARLQNIANLMDNIYTTLANSTFIPHNAIRRGPHQINTTALRCKPHAAVLRLVNILPYVDTSLVQEPDWIYGGHFMDYRNPDQLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q3Q0-F1 | 9-264 | 99.14 | 92.01 | View in AlphaFoldDB ↗ |