DPCfam | MC358446
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 512 ± 63 aa |
| Residues in low-complexity regions (%) | 1.99 |
| Residues in coiled-coil regions (%) | 0.65 |
| Predicted disordered residues (%) | 16.51 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF10540- PF00168 |
| Sequences matching dominant architecture (%) | 48.37 |
| Average overlap percent | 54.93 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J9JVL3 | 727-1301 | 575 | YYAAIYKQHEKLLSNDLSQEIAPICKKVKGADFGMDTPLSPTNSETGESLFELYLAVQEFIRYREHLNASDYQGLSTQCYYHWFE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9Z1N9-F1 | 1044-1592 | 99.81 | 85.64 | View in AlphaFoldDB ↗ |