DPCfam | MC35841
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 257 ± 40 aa |
| Residues in low-complexity regions (%) | 11.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.66 |
| Average transmembrane regions | 0.14 |
| Dominant Pfam architecture(s) | PF10491 |
| Sequences matching dominant architecture (%) | 93.48 |
| Average overlap percent | 80.81 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146M3S1 | 77-277 | 201 | ARPAKRPCYQFETDPTARKRQCNKLLRRLKSILDEFSTRIGQQVAVIVAQPPTTSVRTIKTYGSEPLQRVITRYHPTIIQDLSAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q24312-F1 | 127-346 | 100.00 | 80.12 | View in AlphaFoldDB ↗ |