DPCfam | MC35827
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 229 ± 65 aa |
| Residues in low-complexity regions (%) | 12.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.8 |
| Average transmembrane regions | 3.88 |
| Dominant Pfam architecture(s) | PF01529 |
| Sequences matching dominant architecture (%) | 61.9 |
| Average overlap percent | 19.62 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q76IC6-2 | 15-183 | 169 | EPLCCCEYIDRNGEKNHVAACLCDCQDLDEGCDRWLTCKSLRPETCERITDTISDRLRIPWLRGAKKVNISILPPLVLLPVLLRV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5Y5T3-F1 | 15-281 | 99.57 | 77.09 | View in AlphaFoldDB ↗ |