DPCfam | MC35817
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 87 ± 11 aa |
| Residues in low-complexity regions (%) | 2.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11199 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 32.64 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009DAA675 | 63-143 | 81 | HPSFWGAYDWHSSVHMQCTAVRLLDYVSDEQVKTELSALLSSRLTSINLEIEREYLLANPAYERPYGWAWIIQLAAECQRS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0PAW2-F1 | 39-120 | 93.18 | 97.32 | View in AlphaFoldDB ↗ |