DPCfam | MC35815
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Residues in low-complexity regions (%) | 2.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2Y5Y2 | 177-251 | 75 | VVAPNQELGFAAAVAALGFKLNVSEAEHPLLCEGTRKQKGELALQMLLLYKDQCHKLRMILDSLLDKSLSPNLRA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VWN9-F1 | 1157-1226 | 94.59 | 88.72 | View in AlphaFoldDB ↗ |