DPCfam | MC358133
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 411 |
|---|---|
| Mean domain length (aa) | 162 ± 17 aa |
| Residues in low-complexity regions (%) | 2.09 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 26.48 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02825 |
| Sequences matching dominant architecture (%) | 52.14 |
| Average overlap percent | 45.41 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X7UAN7 | 134-287 | 154 | VIWEFLDETGLWQALSDRESYDIEAHYCDQHNQFLLGDREDKRVHYNLGQMQRLPPKLKHTQRLKRSPFIWERPEVLHQKMNDLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q1L882-F1 | 5-157 | 98.75 | 85.14 | View in AlphaFoldDB ↗ |