DPCfam | MC356852
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 179 ± 20 aa |
| Residues in low-complexity regions (%) | 9.74 |
| Residues in coiled-coil regions (%) | 0.3 |
| Predicted disordered residues (%) | 24.26 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U1HUG4 | 34-233 | 200 | PAYIAVSAASQLVSSELETDGVTISACALTQLNSFLDHILFNILLAAKSTKLSLVKPATQSVLKPKLGKAALAAADEELREYLGD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VNE8-F1 | 57-257 | 93.00 | 85.99 | View in AlphaFoldDB ↗ |