DPCfam | MC356751
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 62 ± 8 aa |
| Residues in low-complexity regions (%) | 0.38 |
| Residues in coiled-coil regions (%) | 0.22 |
| Predicted disordered residues (%) | 28.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13518 |
| Sequences matching dominant architecture (%) | 15.04 |
| Average overlap percent | 25.68 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E3E660 | 27-86 | 60 | VKPSNNRYPSDYRDTILKLIRDHYSDFSPTLAREKLTELHSLPVSNETLRGWMIADGLWK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P55373-F1 | 62-126 | 97.01 | 84.70 | View in AlphaFoldDB ↗ |