DPCfam | MC356682
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 124 ± 10 aa |
| Residues in low-complexity regions (%) | 2.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.66 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF01869 |
| Sequences matching dominant architecture (%) | 95.82 |
| Average overlap percent | 20.63 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S8DZL3 | 521-637 | 117 | DRVVAGKPIGKTVVCQGGTASNGAVVAAFRRILGTNVHVHPYNRLSGAIGVALLAMRSMECAACKTDFAGFEAAKAATVSSFECT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5U925-F1 | 190-261 | 57.94 | 95.67 | View in AlphaFoldDB ↗ |