DPCfam | MC356504
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 511 |
|---|---|
| Mean domain length (aa) | 119 ± 15 aa |
| Residues in low-complexity regions (%) | 0.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02638 |
| Sequences matching dominant architecture (%) | 98.55 |
| Average overlap percent | 21.15 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A8W5H2 | 271-376 | 106 | QSYDDIYADTRTWIQNGWIDYVVPQVYWEMGHPLASYSKLIPWWSNEVKNKNTSLYIGQGIYKDSVAQEIDKQIDLNRTYNEVKG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O35015-F1 | 283-396 | 98.21 | 98.08 | View in AlphaFoldDB ↗ |