DPCfam | MC355988
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 209 ± 36 aa |
| Residues in low-complexity regions (%) | 3.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.49 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF06978 |
| Sequences matching dominant architecture (%) | 15.79 |
| Average overlap percent | 1.95 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K5VY65 | 213-407 | 195 | KLKGPQFILEYILGLICDLQGAGAGATRWVVGSRAFNTHLHKCDFYPFGCLGPATIIWRPLQKNNEPSTDCVATTPDNKTTRNLW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q99575-F1 | 274-523 | 100.00 | 78.71 | View in AlphaFoldDB ↗ |