DPCfam | MC355880
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 74 ± 16 aa |
| Residues in low-complexity regions (%) | 0.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.78 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF12697 |
| Sequences matching dominant architecture (%) | 87.05 |
| Average overlap percent | 20.1 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D2VLG3 | 62-121 | 60 | NLVFLHGTGMNKEIWNYHIEKIFEYCLVKKTEINWKLGKVISVDMVNHCDSYLLNRDKLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W260-F1 | 35-109 | 98.68 | 97.46 | View in AlphaFoldDB ↗ |