DPCfam | MC355818
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 116 ± 14 aa |
| Residues in low-complexity regions (%) | 1.44 |
| Residues in coiled-coil regions (%) | 42.64 |
| Predicted disordered residues (%) | 35.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15903 |
| Sequences matching dominant architecture (%) | 96.3 |
| Average overlap percent | 39.52 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S7H4U9 | 5-110 | 106 | STKLPPTKTPQPERLDEVYAALRKGLQSYLQVHQLELDSLGQQIRENKKNSRLGSLYELDKQVKAIERFMRRLEFHLSKVEELYE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QP98-F1 | 93-219 | 99.22 | 89.17 | View in AlphaFoldDB ↗ |