DPCfam | MC355401
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 422 ± 40 aa |
| Residues in low-complexity regions (%) | 2.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18990 |
| Sequences matching dominant architecture (%) | 98.52 |
| Average overlap percent | 87.58 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I2D1P4 | 11-437 | 427 | IILYLFVLVPLSAQNPMGLYFMETIPQSQKLNPAFQPRANGFFSMPSVNVLMQSDMAFKDAFQDKGSEWVTPLSRRFDYSDLYQV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZKF3-F1 | 258-335 | 15.73 | 95.78 | View in AlphaFoldDB ↗ |