DPCfam | MC355016
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 312 ± 33 aa |
| Residues in low-complexity regions (%) | 2.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.36 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF16756 |
| Sequences matching dominant architecture (%) | 91.43 |
| Average overlap percent | 90.89 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007DB7E1E | 792-1136 | 345 | PSSSFVDVSTVWWEVDGFTALCVVTASEGSVSLWRPLDSGHWALIHTWHFTKVGAVHAGRIIRVGRDHMGHLVQHPARGRDRPFY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZM14-F1 | 784-1108 | 99.39 | 88.84 | View in AlphaFoldDB ↗ |