DPCfam | MC354486
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 81 ± 15 aa |
| Residues in low-complexity regions (%) | 8.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08366 |
| Sequences matching dominant architecture (%) | 97.0 |
| Average overlap percent | 63.3 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3H3V3 | 896-979 | 84 | MPRASYGDRHTVSVMQGTNHVVFDFTSKVIDFTVLSCGDERADDTEDKPEYDDPHTLVVLAEEEIVLVDLQSEGWPTFKQPYLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3TJ91-F1 | 304-396 | 100.00 | 95.65 | View in AlphaFoldDB ↗ |