DPCfam | MC353912
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 129 ± 21 aa |
| Residues in low-complexity regions (%) | 10.62 |
| Residues in coiled-coil regions (%) | 15.3 |
| Predicted disordered residues (%) | 55.43 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009481E13 | 671-841 | 171 | VPPLDLASLHEHGDGDEPIPAGMWHHSLKEEEEATLSPRSTKLKKRQHSTGHSSPIPIHHGVPIHHGMDADFEAPLSPSVLRPLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9DBR2-F1 | 232-362 | 96.95 | 71.65 | View in AlphaFoldDB ↗ |