DPCfam | MC353605
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 86 ± 5 aa |
| Residues in low-complexity regions (%) | 1.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.33 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008F9C61D | 4-88 | 85 | LQLSGRQRKQLRKAILSAYPKFEDLEIFVDENFGENLAAIANSRKYEYTVFDLIQRAEAKGWLDDLIVSLYQDTPDNPDIQQFCA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q382P4-F1 | 646-709 | 68.18 | 81.30 | View in AlphaFoldDB ↗ |