DPCfam | MC353596
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 212 ± 45 aa |
| Residues in low-complexity regions (%) | 1.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 52.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1R1XGJ4 | 136-276 | 140 | SIPRQPAGYEGIQGSVPNEHALILLQALGAWVQGQLRKIDDYASHSANQDPGSPTQSQQISQRWPDDIEMSGELHWQGPVDVSRP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q55H52-F1 | 159-257 | 36.13 | 41.92 | View in AlphaFoldDB ↗ |