DPCfam | MC353320
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 141 ± 22 aa |
| Residues in low-complexity regions (%) | 1.97 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.12 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF08385 |
| Sequences matching dominant architecture (%) | 1.17 |
| Average overlap percent | 16.15 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F7H3C0 | 6-139 | 134 | DVRLEYLEEVASIVLKFKPDKWSKLIGAEENMALFTEFFEKPDVLVLVLTLNVAGMVIPCLGFPESLKSKGVYFIKKKPENITKD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IUQ6-F1 | 10-153 | 98.63 | 85.96 | View in AlphaFoldDB ↗ |