DPCfam | MC353155
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 138 ± 15 aa |
| Residues in low-complexity regions (%) | 4.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.6 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08278 |
| Sequences matching dominant architecture (%) | 88.31 |
| Average overlap percent | 91.34 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| P57164 | 443-568 | 126 | KRTPMRTLIGLLVQNPSLAKLVPVTMKFKNLQIKGLSIFLEILQTCRDNPNIHTGQLLELYRNTTIINVLKILARWDHMIIQKET... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q08346-F1 | 446-579 | 98.53 | 88.59 | View in AlphaFoldDB ↗ |