DPCfam | MC353145
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 139 ± 17 aa |
| Residues in low-complexity regions (%) | 5.16 |
| Residues in coiled-coil regions (%) | 4.03 |
| Predicted disordered residues (%) | 32.9 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A085NFE7 | 660-804 | 145 | PEGLLLYLNSTDQEPPLDNDLSLTCGNMDVNNKNDDNLSDQKEGVVMERLIHVQKAVANQLDSLLQHWFHRHKTELQRKEERAGS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1P6BYH4-F1 | 658-794 | 99.26 | 69.02 | View in AlphaFoldDB ↗ |