DPCfam | MC352548
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 183 ± 30 aa |
| Residues in low-complexity regions (%) | 3.71 |
| Residues in coiled-coil regions (%) | 1.23 |
| Predicted disordered residues (%) | 1.03 |
| Average transmembrane regions | 5.0 |
| Dominant Pfam architecture(s) | PF00810 |
| Sequences matching dominant architecture (%) | 95.45 |
| Average overlap percent | 74.77 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T1DH09 | 5-182 | 178 | LLLAKLWRTKSCSGISGKTQILYSIVFTMRYMDLLSPNHYHSYYVSSAKMAFIALSYLIVYLIYGPYKKSYDRENDVVYNEFLII... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7ERZ5-F1 | 10-199 | 98.96 | 95.13 | View in AlphaFoldDB ↗ |