DPCfam | MC352401
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 181 ± 24 aa |
| Residues in low-complexity regions (%) | 6.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 48.69 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02889 |
| Sequences matching dominant architecture (%) | 85.71 |
| Average overlap percent | 7.04 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E9CVK2 | 930-1098 | 169 | RLHSGQDIMLKAELTHSYQHITCYVMCDEIAGTLRQAELKPNFPESYFSGAKVSRAVTTPWPEKSVARSPIGNATLTGKRPDEFS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NHB3-F1 | 878-1064 | 96.02 | 49.88 | View in AlphaFoldDB ↗ |